BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000287-TA|BGIBMGA000287-PA|IPR009180|Peptidase M22, O-sialoglycoprotein endopeptidase, IPR000905|Peptidase M22, glycoprotease (334 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 24 1.6 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 24.2 bits (50), Expect = 1.6 Identities = 15/72 (20%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 83 ETAVTEALSTAKIKIKDIDAVAVTVKPGLLLSLQVGVQYAKYICMEYNKTIIPVHHMEAH 142 E + + T+K + +D + +P ++ SL Y+ Y Y + ++H+E Sbjct: 53 ENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINHIEQI 112 Query: 143 ALVARIYH-NLP 153 + +Y+ N P Sbjct: 113 PVPVPVYYGNFP 124 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.137 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,168 Number of Sequences: 429 Number of extensions: 4011 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 1 length of query: 334 length of database: 140,377 effective HSP length: 58 effective length of query: 276 effective length of database: 115,495 effective search space: 31876620 effective search space used: 31876620 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -