BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000287-TA|BGIBMGA000287-PA|IPR009180|Peptidase M22,
O-sialoglycoprotein endopeptidase, IPR000905|Peptidase M22,
glycoprotease
(334 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 24 1.6
>DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 24.2 bits (50), Expect = 1.6
Identities = 15/72 (20%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
Query: 83 ETAVTEALSTAKIKIKDIDAVAVTVKPGLLLSLQVGVQYAKYICMEYNKTIIPVHHMEAH 142
E + + T+K + +D + +P ++ SL Y+ Y Y + ++H+E
Sbjct: 53 ENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINHIEQI 112
Query: 143 ALVARIYH-NLP 153
+ +Y+ N P
Sbjct: 113 PVPVPVYYGNFP 124
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.322 0.137 0.410
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,168
Number of Sequences: 429
Number of extensions: 4011
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 334
length of database: 140,377
effective HSP length: 58
effective length of query: 276
effective length of database: 115,495
effective search space: 31876620
effective search space used: 31876620
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -