SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000287-TA|BGIBMGA000287-PA|IPR009180|Peptidase M22,
O-sialoglycoprotein endopeptidase, IPR000905|Peptidase M22,
glycoprotease
         (334 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex det...    24   1.6  

>DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 15/72 (20%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 83  ETAVTEALSTAKIKIKDIDAVAVTVKPGLLLSLQVGVQYAKYICMEYNKTIIPVHHMEAH 142
           E +  +   T+K + +D      + +P ++ SL     Y+ Y    Y +    ++H+E  
Sbjct: 53  ENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINHIEQI 112

Query: 143 ALVARIYH-NLP 153
            +   +Y+ N P
Sbjct: 113 PVPVPVYYGNFP 124


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.322    0.137    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,168
Number of Sequences: 429
Number of extensions: 4011
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 334
length of database: 140,377
effective HSP length: 58
effective length of query: 276
effective length of database: 115,495
effective search space: 31876620
effective search space used: 31876620
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)

- SilkBase 1999-2023 -