BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000285-TA|BGIBMGA000285-PA|IPR000618|Insect cuticle protein (460 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 27 0.28 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 6.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 7.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 7.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 7.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 7.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 7.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 7.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 7.9 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 27.1 bits (57), Expect = 0.28 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Query: 411 KQQKEER--DGEVVKGQYSLVE-PDGSVRTVDYVAD 443 K + EER DG +V G+Y +V DGS+R V Y AD Sbjct: 204 KYRVEERTSDGFIV-GEYGVVSHDDGSLRGVRYTAD 238 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 6.0 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYSTPGVAQV-PEYLGARSN 360 S++ A S+ T S + + +PA + S + S+P S ST + ++S+ Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSSTEKAGTNNNNSKSS 192 Query: 361 YASTP 365 +S P Sbjct: 193 QSSNP 197 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 89 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 132 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 302 SSAPAYSSASFTRHSSPAVAAYSRPAIAPVSTHYSTPVISHYST 345 S++ A S+ T S + + +PA + S + S+P S ST Sbjct: 133 SNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.125 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,559 Number of Sequences: 317 Number of extensions: 4301 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 9 length of query: 460 length of database: 114,650 effective HSP length: 59 effective length of query: 401 effective length of database: 95,947 effective search space: 38474747 effective search space used: 38474747 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -