BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000283-TA|BGIBMGA000283-PA|IPR000618|Insect cuticle protein (204 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 80 4e-17 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 79 7e-17 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 52 1e-08 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 30 0.056 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 29 0.075 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 24 2.8 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 23 4.9 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 6.5 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 6.5 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 8.6 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 149 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 149 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 115 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 173 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 149 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 149 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 80.2 bits (189), Expect = 4e-17 Identities = 35/59 (59%), Positives = 41/59 (69%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH+RIV YH D +GFNA V+ Sbjct: 83 NYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 79.4 bits (187), Expect = 7e-17 Identities = 35/59 (59%), Positives = 40/59 (67%) Query: 50 SYEFSYKVHDPHTHDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 +YEFSY VHD HT D K Q E R DEV G+Y L+ DGH RIV YH D +GFNA V+ Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAVVR 149 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 52.0 bits (119), Expect = 1e-08 Identities = 23/47 (48%), Positives = 30/47 (63%) Query: 62 THDKKGQSENREDDEVKGEYWLIQPDGHKRIVSYHGDKKSGFNADVK 108 T D K Q E+R+ D V+G Y ++ PDG KR V Y D +GFNA V+ Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVR 80 Score = 23.8 bits (49), Expect = 3.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 27 VVVRHKKIINADKKSDEYAWSYPSYEFSYKVHDP 60 V+VRH + D KS + + + SY V DP Sbjct: 25 VLVRHLGALTGDSKSQQESRDGDVVQGSYSVVDP 58 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 29.9 bits (64), Expect = 0.056 Identities = 12/38 (31%), Positives = 17/38 (44%) Query: 34 IINADKKSDEYAWSYPSYEFSYKVHDPHTHDKKGQSEN 71 I+ + K + Y W+ P + Y V H H G S N Sbjct: 82 IVRSSKGVEVYQWNKPDLKLQYTVSKYHDHSGYGSSRN 119 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 29.5 bits (63), Expect = 0.075 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 167 HSSVNLGEYEPLPYRAPVVHKIRENYHHPHYY 198 H SV+ + PL Y+ + ++HHPH++ Sbjct: 135 HPSVHHPAHHPLHYQPAAAAAMHHHHHHPHHH 166 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 24.2 bits (50), Expect = 2.8 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Query: 73 EDDEVKGEYWLIQPDGH--KRIVSYHGDKKSGFNADVKYSEPHKHIDEEKKSHHIPH 127 +D+ VK WL++ G+ + + + KS AD + H+ IDE++ H+ H Sbjct: 167 DDELVKRAQWLLEKLGYPWEMMPLMYVILKS---ADGDVQKAHQRIDEDRLEIHVNH 220 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 23.4 bits (48), Expect = 4.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 109 YSEPHKHIDEEKKSHHIPHYPEVEH 133 YS HK I E K + H P +E+ Sbjct: 192 YSNFHKEIREATKQYVATHCPHLEY 216 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 94 SYHGDKKSGFNADVKYSEPHKHIDEE 119 ++H + N +K+S H ++ EE Sbjct: 504 NHHNGHQRNLNPHIKFSNSHSNLPEE 529 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 94 SYHGDKKSGFNADVKYSEPHKHIDEE 119 ++H + N +K+S H ++ EE Sbjct: 505 NHHNGHQRNLNPHIKFSNSHSNLPEE 530 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 22.6 bits (46), Expect = 8.6 Identities = 11/44 (25%), Positives = 21/44 (47%) Query: 77 VKGEYWLIQPDGHKRIVSYHGDKKSGFNADVKYSEPHKHIDEEK 120 VK +Y+ D H Y + K+GF D + + +H ++ + Sbjct: 1690 VKPDYYFYGQDSHFMNSDYEYNWKNGFGEDEQITILARHGEDNQ 1733 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.134 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,548 Number of Sequences: 2123 Number of extensions: 8641 Number of successful extensions: 27 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 22 length of query: 204 length of database: 516,269 effective HSP length: 61 effective length of query: 143 effective length of database: 386,766 effective search space: 55307538 effective search space used: 55307538 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -