BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000282-TA|BGIBMGA000282-PA|IPR000618|Insect cuticle protein (64 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 84 4e-19 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 83 7e-19 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 83 7e-19 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 82 2e-18 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 58 2e-11 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 22 1.8 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 21 3.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 21 4.2 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 21 5.6 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 20 7.4 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 20 7.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 20 7.4 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 20 9.7 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 84.2 bits (199), Expect = 4e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFN 145 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 145 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 145 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 169 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 145 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 83.4 bits (197), Expect = 7e-19 Identities = 34/54 (62%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+KSQHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 145 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 82.2 bits (194), Expect = 2e-18 Identities = 33/54 (61%), Positives = 42/54 (77%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 Y+F+YSVHD HTGD+K+QHE RHGD V G Y L++ DG R V+Y AD HTG++ Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFN 137 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 58.4 bits (135), Expect = 2e-11 Identities = 25/43 (58%), Positives = 31/43 (72%) Query: 20 TGDVKSQHELRHGDVVRGGYELVEPDGRFRKVEYKADDHTGYD 62 TGD KSQ E R GDVV+G Y +V+PDG R V+Y AD H G++ Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFN 76 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 22.2 bits (45), Expect = 1.8 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 10 KFAYSVHDHHTGDVKSQHELRHGDVV-RGGY 39 K A SV HT K Q +LRH D R GY Sbjct: 10 KGAGSVFRAHTKKRKGQPKLRHLDYAERHGY 40 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 21.4 bits (43), Expect = 3.2 Identities = 10/32 (31%), Positives = 13/32 (40%) Query: 9 YKFAYSVHDHHTGDVKSQHELRHGDVVRGGYE 40 + F S H HH Q + +H GG E Sbjct: 139 HSFGTSTHRHHLPQQYQQQQQQHQLEHNGGRE 170 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 21.0 bits (42), Expect = 4.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 39 YELVEPDGRFRKVEYKADDHTGYDFS 64 Y+ +PD + + K DH+GY S Sbjct: 92 YQWNKPDLKLQYTVSKYHDHSGYGSS 117 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 20.6 bits (41), Expect = 5.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Query: 40 ELVEPDGRFRKVEYKADDHTGY 61 E+ DG FRKV TGY Sbjct: 360 EVASLDGGFRKVRMGDGFFTGY 381 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 20.2 bits (40), Expect = 7.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 39 YELVEPDGRFRKVEYKADDHTGY 61 YE VE D R + YK + T Y Sbjct: 280 YESVELDARIIGIPYKHNVSTMY 302 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 20.2 bits (40), Expect = 7.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 39 YELVEPDGRFRKVE 52 YELV DG FR+ + Sbjct: 431 YELVTIDGCFRRAD 444 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 20.2 bits (40), Expect = 7.4 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Query: 13 YSVHDHHTGDVKSQHELRHGDVVRGGY 39 ++ H H TGD K + L +G RG Y Sbjct: 474 FASHHHSTGDNKPPNLLING---RGKY 497 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 19.8 bits (39), Expect = 9.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 22 DVKSQHELRHGDVVRGGYELVEPDGRFRK 50 DV S +HGDV +++ G FR+ Sbjct: 975 DVGSWQSRKHGDVTFHLSQVLSGHGFFRE 1003 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.139 0.432 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,812 Number of Sequences: 2123 Number of extensions: 2827 Number of successful extensions: 22 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of query: 64 length of database: 516,269 effective HSP length: 43 effective length of query: 21 effective length of database: 424,980 effective search space: 8924580 effective search space used: 8924580 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -