BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000281-TA|BGIBMGA000281-PA|IPR000618|Insect cuticle protein (197 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces ... 29 0.61 SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe... 25 9.9 >SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 28.7 bits (61), Expect = 0.61 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Query: 87 DTYAHPKYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSVRKVDYTADDH 143 DT YDY+ S + H G H ++H GG+ + + G+V Y+ + + Sbjct: 193 DTVGGGAYDYSSSGSHTHGGSHGTEHR---GGSYGNDNTANKTRGAVSSAGYSGEGY 246 >SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 24.6 bits (51), Expect = 9.9 Identities = 9/24 (37%), Positives = 16/24 (66%) Query: 109 KSQHESRDGGAVHGSYSLVEPDGS 132 K+ +S G ++HG YS++E G+ Sbjct: 395 KAIRDSMVGDSIHGLYSILETSGA 418 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.316 0.131 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,913 Number of Sequences: 5004 Number of extensions: 16084 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 3 length of query: 197 length of database: 2,362,478 effective HSP length: 69 effective length of query: 128 effective length of database: 2,017,202 effective search space: 258201856 effective search space used: 258201856 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -