BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000280-TA|BGIBMGA000280-PA|IPR000618|Insect cuticle protein (170 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498,162... 27 6.0 06_03_1075 + 27399279-27399376,27399449-27399555,27400791-274008... 27 8.0 01_05_0082 - 17972276-17973268 27 8.0 >02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498, 1625603-1625887,1626016-1626030,1626339-1626419, 1626909-1627322,1627423-1627719,1627801-1629864 Length = 3057 Score = 27.5 bits (58), Expect = 6.0 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 111 EDYYAHPKYKYSYSVEDPHTG-DHKSQHEVRDGDVVKGEYSLLQPD-GSFRKVSYSAD 166 +D PK ++E+ T H+S HE R G + SL++PD G+ K+ AD Sbjct: 2661 QDDITSPKASQEDALEEVGTELPHESLHENRHGAKDEQTLSLIEPDTGNAEKLPNEAD 2718 >06_03_1075 + 27399279-27399376,27399449-27399555,27400791-27400898, 27401763-27401860,27401983-27402033,27402137-27402228, 27402360-27402459,27402765-27402884,27402977-27403045, 27403299-27403345,27403428-27403483,27404760-27404800, 27405155-27405260,27406728-27406860,27406937-27407357 Length = 548 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 110 HEDY--YAHPKYKYSYSVEDPHTGDHKSQHEVRDGD 143 HEDY Y P + S +D H+S+ + RDGD Sbjct: 476 HEDYNRYCKPGERSSSRHDDRGYSKHESRSKYRDGD 511 >01_05_0082 - 17972276-17973268 Length = 330 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 110 HEDYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGD 143 H+D + HP + E + DH V DGD Sbjct: 204 HDDDHHHPALSHEVHEESAGSHDHDDDDHVDDGD 237 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.132 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,757,435 Number of Sequences: 37544 Number of extensions: 118160 Number of successful extensions: 139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 137 Number of HSP's gapped (non-prelim): 4 length of query: 170 length of database: 14,793,348 effective HSP length: 77 effective length of query: 93 effective length of database: 11,902,460 effective search space: 1106928780 effective search space used: 1106928780 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -