Silkworm BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000280-TA|BGIBMGA000280-PA|IPR000618|Insect cuticle
protein
         (170 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z99942-7|CAB17070.2|  462|Caenorhabditis elegans Hypothetical pr...    29   2.3  

>Z99942-7|CAB17070.2|  462|Caenorhabditis elegans Hypothetical
           protein H13N06.5 protein.
          Length = 462

 Score = 28.7 bits (61), Expect = 2.3
 Identities = 10/31 (32%), Positives = 16/31 (51%)

Query: 107 GHGHEDYYAHPKYKYSYSVEDPHTGDHKSQH 137
           GH H+  +AH  + +S+  E+ H   H   H
Sbjct: 87  GHAHDHGHAHDHHGHSHDEEEDHHHGHAHDH 117


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.314    0.132    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,004,462
Number of Sequences: 27539
Number of extensions: 91808
Number of successful extensions: 147
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 146
Number of HSP's gapped (non-prelim): 1
length of query: 170
length of database: 12,573,161
effective HSP length: 76
effective length of query: 94
effective length of database: 10,480,197
effective search space: 985138518
effective search space used: 985138518
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 56 (26.6 bits)