BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000280-TA|BGIBMGA000280-PA|IPR000618|Insect cuticle protein (170 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 31 0.005 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 2.3 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 2.3 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 31.1 bits (67), Expect = 0.005 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Query: 120 KYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQ-PDGSFRKVSYSAD 166 K Y VE + ++ + DG +V GEY ++ DGS R V Y+AD Sbjct: 192 KVGYVVEGRNYRKYRVEERTSDGFIV-GEYGVVSHDDGSLRGVRYTAD 238 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.2 bits (45), Expect = 2.3 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Query: 111 EDYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVV 145 E+Y H Y Y E P+ +H H DG V Sbjct: 369 ENYINHQNYVQGYQGEHPNY-NHYGYHYSGDGGEV 402 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.2 bits (45), Expect = 2.3 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Query: 111 EDYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVV 145 E+Y H Y Y E P+ +H H DG V Sbjct: 317 ENYINHQNYVQGYQGEHPNY-NHYGYHYSGDGGEV 350 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.132 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,962 Number of Sequences: 317 Number of extensions: 910 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 170 length of database: 114,650 effective HSP length: 53 effective length of query: 117 effective length of database: 97,849 effective search space: 11448333 effective search space used: 11448333 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -