BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000280-TA|BGIBMGA000280-PA|IPR000618|Insect cuticle protein (170 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 77 4e-16 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 76 7e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 76 7e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 75 2e-15 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 61 2e-11 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 24 2.9 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 24 2.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 5.0 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 6.6 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 76.6 bits (180), Expect = 4e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 109 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 75.8 bits (178), Expect = 7e-16 Identities = 34/59 (57%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD KSQHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 74.5 bits (175), Expect = 2e-15 Identities = 33/59 (55%), Positives = 41/59 (69%) Query: 112 DYYAHPKYKYSYSVEDPHTGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 +++A Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 60.9 bits (141), Expect = 2e-11 Identities = 26/41 (63%), Positives = 32/41 (78%) Query: 130 TGDHKSQHEVRDGDVVKGEYSLLQPDGSFRKVSYSADDHSG 170 TGD KSQ E RDGDVV+G YS++ PDG+ R V Y+AD H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 127 IGTYKIHRREDLYPHPE 143 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 127 IGTYKIHRREDLYPHPE 143 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 127 IGTYKIHRREDLYPHPE 143 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 127 IGTYKIHRREDLYPHPE 143 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 130 IGTYKIHRREDLYPHPE 146 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 130 IGTYKIHRREDLYPHPE 146 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 141 IGTYKIHRREDLYPHPE 157 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 141 IGTYKIHRREDLYPHPE 157 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 127 IGTYKIHRREDLYPHPE 143 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 127 IGTYKIHRREDLYPHPE 143 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 141 IGTYKIHRREDLYPHPE 157 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 141 IGTYKIHRREDLYPHPE 157 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 141 IGTYKIHRREDLYPHPE 157 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 141 IGTYKIHRREDLYPHPE 157 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 126 IGTYKIHRREDLYPHPE 142 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 126 IGTYKIHRREDLYPHPE 142 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 139 IGTYKIHRREDLYPHPE 155 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 140 IGTYKIHRREDLYPHPE 156 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 140 IGTYKIHRREDLYPHPE 156 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 138 IGTYKIHRREDLYPHPE 154 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 23.8 bits (49), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 102 LGAYSGHGHEDYYAHPK 118 +G Y H ED Y HP+ Sbjct: 102 IGTYKIHRREDLYPHPE 118 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 5.0 Identities = 11/19 (57%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Query: 111 EDYYAHPKYKYSYSVEDPH 129 +DY KYK SYS E PH Sbjct: 1797 KDYTVDGKYKRSYSYE-PH 1814 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LGAYSGHGHEDYYAHPKYKYS 122 LGAYSG G + H +K++ Sbjct: 227 LGAYSGTGGDSLTYHKGHKFT 247 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.132 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,407 Number of Sequences: 2123 Number of extensions: 3721 Number of successful extensions: 76 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 73 length of query: 170 length of database: 516,269 effective HSP length: 60 effective length of query: 110 effective length of database: 388,889 effective search space: 42777790 effective search space used: 42777790 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -