BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000278-TA|BGIBMGA000278-PA|IPR000618|Insect cuticle protein (163 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z11505-7|CAA77581.1| 918|Caenorhabditis elegans Hypothetical pr... 28 2.8 AL132948-1|CAC51077.1| 735|Caenorhabditis elegans Hypothetical ... 27 8.7 >Z11505-7|CAA77581.1| 918|Caenorhabditis elegans Hypothetical protein F59B2.12 protein. Length = 918 Score = 28.3 bits (60), Expect = 2.8 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Query: 84 YAHPKYDFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDGSVRKVDYTADEHHGFN 142 +A PK D + + + HK H+S S S ++V DG + + +++ G+N Sbjct: 55 FAMPKLDASKAAMVHSSSSHKGHHQSSGSSSNTHSLTVVGADG--KNITENSEKKDGYN 111 >AL132948-1|CAC51077.1| 735|Caenorhabditis elegans Hypothetical protein Y39B6A.1 protein. Length = 735 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/43 (25%), Positives = 18/43 (41%) Query: 78 YAGHDEYAHPKYDFAYSVADPHTGDHKSQHESRDGDSVHGSYS 120 + H AH + A+ H G H H+ ++ HG +S Sbjct: 677 HGAHHSPAHHGHHGAHHEHGAHHGAHHGHHDDKENHHHHGHHS 719 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.315 0.131 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,951,289 Number of Sequences: 27539 Number of extensions: 95099 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 99 Number of HSP's gapped (non-prelim): 4 length of query: 163 length of database: 12,573,161 effective HSP length: 76 effective length of query: 87 effective length of database: 10,480,197 effective search space: 911777139 effective search space used: 911777139 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -