BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000276-TA|BGIBMGA000276-PA|IPR000618|Insect cuticle protein (161 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0779 + 23082577-23082903,23083347-23083543,23084346-230844... 30 0.77 03_05_0701 - 26925252-26925578,26929233-26930513 29 1.3 02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498,162... 29 1.8 03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980,648... 29 2.4 02_04_0117 + 19914704-19915830,19916575-19916860,19917047-19918258 29 2.4 01_01_0586 - 4353919-4353973,4354623-4354940,4355043-4355323 28 4.1 11_03_0010 - 8922361-8922375,8923888-8924610 27 7.2 09_04_0011 + 13703564-13703766,13704685-13705526,13705628-137057... 27 7.2 08_02_0952 - 22981116-22981268,22981930-22981974,22982052-229821... 27 7.2 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 27 7.2 05_07_0146 + 28018236-28018580,28018670-28018777,28018984-280191... 27 9.5 >12_02_0779 + 23082577-23082903,23083347-23083543,23084346-23084481, 23084558-23084794,23084885-23085108,23085434-23085551, 23086080-23086319,23086423-23086673,23088397-23088484, 23088576-23088727,23089670-23089811 Length = 703 Score = 30.3 bits (65), Expect = 0.77 Identities = 11/39 (28%), Positives = 25/39 (64%) Query: 102 DHKSQHESRDGDSVHGSYSLVQPDGSVRKVDYTADEHHG 140 ++K +S+D +++G + + +GS+R++D A+E G Sbjct: 260 EYKKFLKSKDNQNINGGLANLAEEGSLRRIDSNAEESDG 298 >03_05_0701 - 26925252-26925578,26929233-26930513 Length = 535 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/56 (28%), Positives = 21/56 (37%) Query: 101 GDHKSQHESRDGDSVHGSYSLVQPDGSVRKVDYTADEHHGFNAIVHNSAPSVHPIA 156 G K Q + GD+ HG + P S +H A +S PS H A Sbjct: 9 GGRKGQRAADGGDAAHGRPAAAAPSSSSGGAQPPVTVNHASRAAAPSSPPSPHAAA 64 >02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498, 1625603-1625887,1626016-1626030,1626339-1626419, 1626909-1627322,1627423-1627719,1627801-1629864 Length = 3057 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 103 HKSQHESRDGDSVHGSYSLVQPD-GSVRKVDYTAD 136 H+S HE+R G + SL++PD G+ K+ AD Sbjct: 2684 HESLHENRHGAKDEQTLSLIEPDTGNAEKLPNEAD 2718 >03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980, 6483158-6483234,6483990-6485312 Length = 691 Score = 28.7 bits (61), Expect = 2.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Query: 90 DFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDGSVRK--VDYTADEHHGF-NAIVH 146 ++A S D G KSQ + RD D G P + +K V ++ + H F NA+ H Sbjct: 162 EYASSANDGAEGSWKSQKKKRDKDDDDGELESGDPSSTSKKPRVVWSVELHQQFVNAVNH 221 >02_04_0117 + 19914704-19915830,19916575-19916860,19917047-19918258 Length = 874 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Query: 127 SVRKVDYTADEHHGFNAIVHNSAPS 151 SV K+D D+HHG A+ ++PS Sbjct: 801 SVEKLDQDGDDHHGKEAVAAAASPS 825 >01_01_0586 - 4353919-4353973,4354623-4354940,4355043-4355323 Length = 217 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 136 DEHHGFNAIVHNSAPSVHPIAHHHH 160 D HH A + APS P HHHH Sbjct: 52 DHHHPTTAAASSHAPSP-PTLHHHH 75 >11_03_0010 - 8922361-8922375,8923888-8924610 Length = 245 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 110 RDGDSVHGSYSLVQPDGSVRKVD 132 RDG V +YS P GS+R VD Sbjct: 195 RDGSDVPAAYSTGCPAGSIRNVD 217 >09_04_0011 + 13703564-13703766,13704685-13705526,13705628-13705704, 13706294-13706339,13706479-13706722,13710078-13710150, 13711119-13711235 Length = 533 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Query: 73 TPLAHYSGHHEYAHPKYDFAYSVADPHT 100 +P A GHH + HPK F S P T Sbjct: 195 SPTAGDVGHHHHHHPKMGFYSSYHHPST 222 >08_02_0952 - 22981116-22981268,22981930-22981974,22982052-22982153, 22983262-22983468,22984783-22985042,22985338-22985442, 22986244-22986247,22986877-22986962,22987022-22987064 Length = 334 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/63 (22%), Positives = 24/63 (38%) Query: 99 HTGDHKSQHESRDGDSVHGSYSLVQPDGSVRKVDYTADEHHGFNAIVHNSAPSVHPIAHH 158 HT DH++ + S + H L + + + + NS H + HH Sbjct: 50 HTHDHQNHNHSHEHSHAHSLEDLSIGLSVLFGIVFFFIVEKIVRYVEDNSQKGAHGMGHH 109 Query: 159 HHY 161 HH+ Sbjct: 110 HHH 112 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 90 DFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDG 126 D Y D H+ + +HE+ +GDS SYS + DG Sbjct: 443 DSEYDGLDEHSSE--GEHEALNGDSSGASYSSGEIDG 477 >05_07_0146 + 28018236-28018580,28018670-28018777,28018984-28019148, 28019269-28019736,28019823-28019936,28020038-28020715 Length = 625 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/35 (31%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Query: 74 PLAHYSGHHEYAHPKYDFAYSVADPHTGDHKSQHE 108 PL H+ HH + HP + + P DH H+ Sbjct: 272 PLPHFD-HHNHHHPIHGGRERGSSPAEADHHRHHQ 305 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.131 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,766,728 Number of Sequences: 37544 Number of extensions: 138525 Number of successful extensions: 392 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 384 Number of HSP's gapped (non-prelim): 15 length of query: 161 length of database: 14,793,348 effective HSP length: 77 effective length of query: 84 effective length of database: 11,902,460 effective search space: 999806640 effective search space used: 999806640 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -