BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000276-TA|BGIBMGA000276-PA|IPR000618|Insect cuticle protein (161 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 25 0.28 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 0.64 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 25.4 bits (53), Expect = 0.28 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query: 117 GSYSLVQPDGSVRKVDYTADEHHGFNAIVHNSAPSVHPI 155 GS S PDG + Y ADE +GF + + P+ PI Sbjct: 73 GSDSYTAPDGQQVSITYVADE-NGFQ-VQGSHIPTAPPI 109 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.2 bits (50), Expect = 0.64 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 146 HNSAPSVHPIAHHHHY 161 H P++ P HHHH+ Sbjct: 341 HTMGPTMGPPHHHHHH 356 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.131 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,688 Number of Sequences: 429 Number of extensions: 1037 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 161 length of database: 140,377 effective HSP length: 53 effective length of query: 108 effective length of database: 117,640 effective search space: 12705120 effective search space used: 12705120 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -