BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000275-TA|BGIBMGA000275-PA|IPR000618|Insect cuticle protein (179 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomy... 28 0.69 SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe... 27 1.2 >SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomyces pombe|chr 3|||Manual Length = 286 Score = 28.3 bits (60), Expect = 0.69 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 89 AAPLGHYSGHDEYAHPK-YDFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDG 143 A P H G D+ H +D+ + D H DH S S + S +Q G Sbjct: 2 AIPFLHKGGSDDSTHHHTHDYDHHNHDHHGHDHHSHDSSSNSSSEAARLQFIQEHG 57 >SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 27.5 bits (58), Expect = 1.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Query: 121 KSQHESRDGDSVHGSYSLVQPDGS 144 K+ +S GDS+HG YS+++ G+ Sbjct: 395 KAIRDSMVGDSIHGLYSILETSGA 418 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.317 0.133 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,577 Number of Sequences: 5004 Number of extensions: 17198 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 2 length of query: 179 length of database: 2,362,478 effective HSP length: 69 effective length of query: 110 effective length of database: 2,017,202 effective search space: 221892220 effective search space used: 221892220 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -