BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000275-TA|BGIBMGA000275-PA|IPR000618|Insect cuticle protein (179 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0779 + 23082577-23082903,23083347-23083543,23084346-230844... 30 0.92 02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498,162... 29 2.1 01_06_1753 - 39664219-39665445 29 2.8 11_03_0010 - 8922361-8922375,8923888-8924610 27 8.6 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 27 8.6 03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980,648... 27 8.6 >12_02_0779 + 23082577-23082903,23083347-23083543,23084346-23084481, 23084558-23084794,23084885-23085108,23085434-23085551, 23086080-23086319,23086423-23086673,23088397-23088484, 23088576-23088727,23089670-23089811 Length = 703 Score = 30.3 bits (65), Expect = 0.92 Identities = 11/39 (28%), Positives = 25/39 (64%) Query: 119 DHKSQHESRDGDSVHGSYSLVQPDGSVRKVDYTADEHHG 157 ++K +S+D +++G + + +GS+R++D A+E G Sbjct: 260 EYKKFLKSKDNQNINGGLANLAEEGSLRRIDSNAEESDG 298 >02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498, 1625603-1625887,1626016-1626030,1626339-1626419, 1626909-1627322,1627423-1627719,1627801-1629864 Length = 3057 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 120 HKSQHESRDGDSVHGSYSLVQPD-GSVRKVDYTAD 153 H+S HE+R G + SL++PD G+ K+ AD Sbjct: 2684 HESLHENRHGAKDEQTLSLIEPDTGNAEKLPNEAD 2718 >01_06_1753 - 39664219-39665445 Length = 408 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/69 (28%), Positives = 27/69 (39%), Gaps = 4/69 (5%) Query: 89 AAPLGHYS--GHDEYAHPKYDFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDGSVR 146 AA GH+S GH +Y H Y+ +D + ES D D + GSV Sbjct: 280 AAAAGHHSSGGHTQYHHQSYECEEEDSDEDDCEDDDDDESDDDDD--DGHCPPSRQGSVH 337 Query: 147 KVDYTADEH 155 A +H Sbjct: 338 SYHQAAYQH 346 >11_03_0010 - 8922361-8922375,8923888-8924610 Length = 245 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 127 RDGDSVHGSYSLVQPDGSVRKVD 149 RDG V +YS P GS+R VD Sbjct: 195 RDGSDVPAAYSTGCPAGSIRNVD 217 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 107 DFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDG 143 D Y D H+ + +HE+ +GDS SYS + DG Sbjct: 443 DSEYDGLDEHSSE--GEHEALNGDSSGASYSSGEIDG 477 >03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980, 6483158-6483234,6483990-6485312 Length = 691 Score = 27.1 bits (57), Expect = 8.6 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Query: 107 DFAYSVADPHTGDHKSQHESRDGDSVHGSYSLVQPDGSVRK--VDYTADEHHGF-NAV 161 ++A S D G KSQ + RD D G P + +K V ++ + H F NAV Sbjct: 162 EYASSANDGAEGSWKSQKKKRDKDDDDGELESGDPSSTSKKPRVVWSVELHQQFVNAV 219 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.133 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,707,541 Number of Sequences: 37544 Number of extensions: 120094 Number of successful extensions: 228 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 226 Number of HSP's gapped (non-prelim): 6 length of query: 179 length of database: 14,793,348 effective HSP length: 78 effective length of query: 101 effective length of database: 11,864,916 effective search space: 1198356516 effective search space used: 1198356516 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -