BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000274-TA|BGIBMGA000274-PA|undefined (380 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0022 + 3065644-3065953,3066048-3067162,3067261-3067437,306... 30 3.5 04_01_0382 - 5076673-5077774,5078122-5078186 29 8.2 >09_02_0022 + 3065644-3065953,3066048-3067162,3067261-3067437, 3067535-3067648,3068614-3068718,3068930-3069064, 3069148-3069203,3069277-3069382,3069515-3069631, 3069705-3069831,3069915-3070141,3070164-3070727 Length = 1050 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Query: 7 VAVFILGVSAINVVTGASFSKVFVQGGREVVPVEYLQYGAPSIAVA--GSQLAQISAA 62 V +GV + VT +F ++F +GG + + L G P + A G QLA +S A Sbjct: 544 VKAVAVGVGWVAAVTTLNFLRIFTEGG---LQMHILSVGGPVVTAAGHGDQLAIVSHA 598 >04_01_0382 - 5076673-5077774,5078122-5078186 Length = 388 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Query: 135 DGFNAVVKKFLPVNVEKKIEQHEKSHPDP--PCHEVKNEQLKVETKTEHSE 183 DG N +V+ LP +EKK+ ++ PD H++ +++ K + HSE Sbjct: 273 DGRNKLVEYRLPPKIEKKVVNEQRYVPDTRYVLHDI-DQEAKEQALLYHSE 322 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.313 0.130 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,258,540 Number of Sequences: 37544 Number of extensions: 256194 Number of successful extensions: 497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 496 Number of HSP's gapped (non-prelim): 3 length of query: 380 length of database: 14,793,348 effective HSP length: 83 effective length of query: 297 effective length of database: 11,677,196 effective search space: 3468127212 effective search space used: 3468127212 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -