BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000274-TA|BGIBMGA000274-PA|undefined (380 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.3 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 157 EKSHPDPPCHEVKNEQL 173 EK PDPP + V NE + Sbjct: 264 EKCRPDPPQNLVINESI 280 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 6.3 Identities = 14/61 (22%), Positives = 27/61 (44%) Query: 106 NKEDAAGYEYSYLVYDENTGDHKTQHELSDGFNAVVKKFLPVNVEKKIEQHEKSHPDPPC 165 N++ + + S V D +T D T E ++G + V + +EK + + + P Sbjct: 693 NEKSPSPQQRSPSVTDLSTKDGTTVPESNNGSSPSVLNAIEKLIEKSFDSRSRQNSSFPG 752 Query: 166 H 166 H Sbjct: 753 H 753 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.130 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,240 Number of Sequences: 317 Number of extensions: 2141 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 380 length of database: 114,650 effective HSP length: 58 effective length of query: 322 effective length of database: 96,264 effective search space: 30997008 effective search space used: 30997008 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -