BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000274-TA|BGIBMGA000274-PA|undefined (380 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 40 1e-04 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 40 1e-04 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 40 2e-04 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 40 2e-04 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 40 2e-04 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 40 2e-04 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 39 2e-04 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 39 2e-04 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 39 2e-04 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 39 2e-04 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 39 2e-04 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 39 2e-04 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 39 2e-04 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 27 1.1 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 24 6.0 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 39.9 bits (89), Expect = 1e-04 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 10/94 (10%) Query: 48 SIAVAGSQLAQISAAP----VGSV-VPNLVAPCGTPCIYPGQSIAPATTNXXXXXXXXXX 102 SIA + S + Q AAP VGSV + P IY Q APA Sbjct: 27 SIATSHSSI-QHHAAPAIHHVGSVHAAPAIYQHSAPAIY--QHSAPAIVKTIAQPTIIKS 83 Query: 103 XXXNKEDAAGYEYSYLVYDENTGDHKTQHELSDG 136 + A YE+SY V+DE+TGD K+QHE G Sbjct: 84 VEHHAP--ANYEFSYSVHDEHTGDIKSQHETRHG 115 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 39.9 bits (89), Expect = 1e-04 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 11/90 (12%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDGFNAVVK-KFLPVNVEKKIEQHEKSH--------- 160 A YE+SY V+DE+TGD K QHE G + L + ++I + H Sbjct: 82 ANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 Query: 161 PDPPCHEVKNEQLKVETKTEHSESH-HAPI 189 P+P ++ KV + H S+ HAP+ Sbjct: 142 PEPSAVKIAQPVHKVIAQPVHVSSYAHAPV 171 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 39.5 bits (88), Expect = 2e-04 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 10/94 (10%) Query: 48 SIAVAGSQLAQISAAP----VGSV-VPNLVAPCGTPCIYPGQSIAPATTNXXXXXXXXXX 102 SIA + S + Q AAP VGSV + P IY Q APA Sbjct: 27 SIATSHSTI-QHHAAPAIHHVGSVHAAPAIYQHSAPAIY--QHSAPAIVKTIAQPTIIKS 83 Query: 103 XXXNKEDAAGYEYSYLVYDENTGDHKTQHELSDG 136 + A YE+SY V+DE+TGD K+QHE G Sbjct: 84 VEHHAP--ANYEFSYSVHDEHTGDIKSQHETRHG 115 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 39.5 bits (88), Expect = 2e-04 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 10/94 (10%) Query: 48 SIAVAGSQLAQISAAP----VGSV-VPNLVAPCGTPCIYPGQSIAPATTNXXXXXXXXXX 102 SIA + S + Q AAP VGSV + P IY Q APA Sbjct: 27 SIATSHSTI-QHHAAPTIQHVGSVHAAPAIYQHSAPAIY--QHSAPAIVKTIAQPTIIKS 83 Query: 103 XXXNKEDAAGYEYSYLVYDENTGDHKTQHELSDG 136 + A YE+SY V+DE+TGD K+QHE G Sbjct: 84 VEHHAP--ANYEFSYSVHDEHTGDIKSQHETRHG 115 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 39.5 bits (88), Expect = 2e-04 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 10/94 (10%) Query: 48 SIAVAGSQLAQISAAP----VGSV-VPNLVAPCGTPCIYPGQSIAPATTNXXXXXXXXXX 102 SIA + S + Q AAP VGSV + P IY Q APA Sbjct: 27 SIATSHSTI-QHHAAPAIHHVGSVHAAPAIYQHSAPAIY--QHSAPAIVKTIAQPTIIKS 83 Query: 103 XXXNKEDAAGYEYSYLVYDENTGDHKTQHELSDG 136 + A YE+SY V+DE+TGD K+QHE G Sbjct: 84 VEHHAP--ANYEFSYSVHDEHTGDIKSQHETRHG 115 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 39.5 bits (88), Expect = 2e-04 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 10/94 (10%) Query: 48 SIAVAGSQLAQISAAP----VGSV-VPNLVAPCGTPCIYPGQSIAPATTNXXXXXXXXXX 102 SIA + S + Q AAP VGSV + P IY Q APA Sbjct: 27 SIATSHSTI-QHHAAPTIQHVGSVHAAPAIYQHSAPAIY--QHSAPAIVKTIAQPTIIKS 83 Query: 103 XXXNKEDAAGYEYSYLVYDENTGDHKTQHELSDG 136 + A YE+SY V+DE+TGD K+QHE G Sbjct: 84 VEHHAP--ANYEFSYSVHDEHTGDIKSQHETRHG 115 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 82 ANYEFSYSVHDEHTGDIKSQHETRHG 107 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 82 ANYEFSYSVHDEHTGDIKSQHETRHG 107 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 82 ANYEFSYSVHDEHTGDIKSQHETRHG 107 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 82 ANYEFSYSVHDEHTGDIKSQHETRHG 107 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 114 ANYEFSYSVHDEHTGDIKSQHETRHG 139 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 82 ANYEFSYSVHDEHTGDIKSQHETRHG 107 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 39.1 bits (87), Expect = 2e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 111 AGYEYSYLVYDENTGDHKTQHELSDG 136 A YE+SY V+DE+TGD K+QHE G Sbjct: 82 ANYEFSYSVHDEHTGDIKSQHETRHG 107 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 26.6 bits (56), Expect = 1.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 131 HELSDGFNAVVKKFLPVNVEKKIEQHEKSHPDPPCHEVKNEQL-KVETKTEHSES 184 HE+S+ V +LP + HP P + KN+QL +VE + S+S Sbjct: 309 HEMSEWIRVVFLIWLPFILRMSRPGEPYPHPCRPTVDEKNKQLQEVEMRERSSKS 363 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.2 bits (50), Expect = 6.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 42 LQYGAPSIAVAGSQLAQISAAPVGSVVPNLVAP 74 +Q G V G+ +IS S+ PNL+AP Sbjct: 781 IQQGGDGRFVIGASTGEISITHGASLDPNLLAP 813 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.130 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 255,169 Number of Sequences: 2123 Number of extensions: 9280 Number of successful extensions: 25 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 15 length of query: 380 length of database: 516,269 effective HSP length: 65 effective length of query: 315 effective length of database: 378,274 effective search space: 119156310 effective search space used: 119156310 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -