BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000274-TA|BGIBMGA000274-PA|undefined (380 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 10.0 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 10.0 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 10.0 Identities = 8/36 (22%), Positives = 16/36 (44%) Query: 150 EKKIEQHEKSHPDPPCHEVKNEQLKVETKTEHSESH 185 + ++E H D P + + +VE K E ++ Sbjct: 192 QSEVESTSSLHSDMPIERILEAEKRVECKMEQQGNY 227 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 10.0 Identities = 8/36 (22%), Positives = 16/36 (44%) Query: 150 EKKIEQHEKSHPDPPCHEVKNEQLKVETKTEHSESH 185 + ++E H D P + + +VE K E ++ Sbjct: 192 QSEVESTSSLHSDMPIERILEAEKRVECKMEQQGNY 227 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.130 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,933 Number of Sequences: 429 Number of extensions: 2506 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 380 length of database: 140,377 effective HSP length: 59 effective length of query: 321 effective length of database: 115,066 effective search space: 36936186 effective search space used: 36936186 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -