BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000273-TA|BGIBMGA000273-PA|IPR000618|Insect cuticle protein (117 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 78 7e-17 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 77 1e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 77 1e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 77 2e-16 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 64 1e-12 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 22 5.0 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 21 8.7 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 78.2 bits (184), Expect = 7e-17 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 108 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 77.4 bits (182), Expect = 1e-16 Identities = 35/60 (58%), Positives = 41/60 (68%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K+QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 77.0 bits (181), Expect = 2e-16 Identities = 35/60 (58%), Positives = 40/60 (66%) Query: 58 VDYHAHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 V++HA Y++SYSV D HTGD K QHE R GD V G+YSLL DG R V Y AD H G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 64.1 bits (149), Expect = 1e-12 Identities = 27/41 (65%), Positives = 33/41 (80%) Query: 77 TGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYTADDHNG 117 TGD K+Q E+RDGDVV+G YS++ PDG+ R V YTAD HNG Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Query: 90 DVVKGEYSLLQPDGSFRKVTYTADDH 115 DV S+ +PD +YTA DH Sbjct: 186 DVAFASPSIARPDTWVVSTSYTASDH 211 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/31 (29%), Positives = 14/31 (45%) Query: 63 HPKYDYSYSVSDPHTGDHKTQHEARDGDVVK 93 H ++D S GDH + D D+V+ Sbjct: 305 HVEFDIEGSKMRYEAGDHLAMYPVNDRDLVE 335 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.132 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,206 Number of Sequences: 2123 Number of extensions: 2746 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 16 length of query: 117 length of database: 516,269 effective HSP length: 56 effective length of query: 61 effective length of database: 397,381 effective search space: 24240241 effective search space used: 24240241 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -