BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000273-TA|BGIBMGA000273-PA|IPR000618|Insect cuticle protein (117 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 30 0.007 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 29.9 bits (64), Expect = 0.007 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 70 YSVSDPHTGDHKTQHEARDGDVVKGEYSLLQ-PDGSFRKVTYTAD 113 Y V + ++ + DG +V GEY ++ DGS R V YTAD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIV-GEYGVVSHDDGSLRGVRYTAD 238 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.132 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,803 Number of Sequences: 317 Number of extensions: 703 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 117 length of database: 114,650 effective HSP length: 50 effective length of query: 67 effective length of database: 98,800 effective search space: 6619600 effective search space used: 6619600 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.0 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -