BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000272-TA|BGIBMGA000272-PA|IPR000618|Insect cuticle protein, IPR000583|Glutamine amidotransferase, class-II (297 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 35 6e-04 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 4.8 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 35.1 bits (77), Expect = 6e-04 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Query: 106 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQ-PDGSIR 164 +P E S ++D+ + Y VE + ++ + T DG +V GEY ++ DGS+R Sbjct: 177 LPSKEEVSKKIDDNQ----KVGYVVEGRNYRKYRVEERTSDGFIV-GEYGVVSHDDGSLR 231 Query: 165 KVEYTAD 171 V YTAD Sbjct: 232 GVRYTAD 238 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 152 GEYSLLQPDGSIRKVEYTADHHNGFSA 178 G Y P+G I + + + NG+SA Sbjct: 142 GSYDPYSPNGKIGREDLSPSSLNGYSA 168 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.130 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,244 Number of Sequences: 317 Number of extensions: 2921 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 297 length of database: 114,650 effective HSP length: 56 effective length of query: 241 effective length of database: 96,898 effective search space: 23352418 effective search space used: 23352418 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -