BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000268-TA|BGIBMGA000268-PA|IPR000618|Insect cuticle protein (166 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 25 0.25 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 2.3 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 4.0 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 5.3 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 7.0 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 25.4 bits (53), Expect = 0.25 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Query: 104 QQEVRDGDVVKGSYSF--HEADGSIRTVEYTAD 134 ++ DG +V G Y H+ DGS+R V YTAD Sbjct: 208 EERTSDGFIV-GEYGVVSHD-DGSLRGVRYTAD 238 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 2.3 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Query: 116 SYSFHEADGSIRTVEYTADDHNGFNAVVHNTAPTSAPTL 154 SY F++ + + Y D H GF+ V + T P L Sbjct: 431 SYDFYKMNHPV----YHKDPHYGFHNVTNTTLQNLTPQL 465 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 114 KGSYSFHEADGSIRTVEYTADDHNG 138 K SY+ + G I V+ T DD G Sbjct: 390 KASYARAKGLGGIAIVDITLDDFRG 414 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.0 bits (42), Expect = 5.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Query: 110 GDVVKGSYSFHEADGSIRTVEYTADDHNGFNAVVHNTAPTSAPTLIKA 157 GD+ KG+++ EA I T G+NA AP +A ++A Sbjct: 76 GDIEKGNFAEVEALKEINPNLKTIISIGGWNAGNAILAPIAASPELRA 123 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 20.6 bits (41), Expect = 7.0 Identities = 10/39 (25%), Positives = 18/39 (46%) Query: 115 GSYSFHEADGSIRTVEYTADDHNGFNAVVHNTAPTSAPT 153 GSY + +G I + + NG++A ++ PT Sbjct: 142 GSYDPYSPNGKIGREDLSPSSLNGYSADSCDSKKKKGPT 180 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,888 Number of Sequences: 317 Number of extensions: 1077 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 166 length of database: 114,650 effective HSP length: 52 effective length of query: 114 effective length of database: 98,166 effective search space: 11190924 effective search space used: 11190924 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -