SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000268-TA|BGIBMGA000268-PA|IPR000618|Insect cuticle
protein
         (166 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0474 - 34184002-34184660,34184755-34184887,34185071-341858...    28   3.3  

>03_06_0474 -
           34184002-34184660,34184755-34184887,34185071-34185886,
           34186013-34186104,34186710-34186863
          Length = 617

 Score = 28.3 bits (60), Expect = 3.3
 Identities = 15/41 (36%), Positives = 19/41 (46%)

Query: 114 KGSYSFHEADGSIRTVEYTADDHNGFNAVVHNTAPTSAPTL 154
           K SY++    GS  T  Y +  H  FN   H+T P   P L
Sbjct: 144 KFSYNWKSLHGSSTTSSYGSPCHPMFNLSKHSTNPKPPPPL 184


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.314    0.129    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,230,946
Number of Sequences: 37544
Number of extensions: 147782
Number of successful extensions: 262
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 261
Number of HSP's gapped (non-prelim): 1
length of query: 166
length of database: 14,793,348
effective HSP length: 77
effective length of query: 89
effective length of database: 11,902,460
effective search space: 1059318940
effective search space used: 1059318940
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 57 (27.1 bits)

- SilkBase 1999-2023 -