BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000266-TA|BGIBMGA000266-PA|IPR000618|Insect cuticle protein (248 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) 31 0.68 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 196 KGSYSFHEADGSIRTVEYTADDHSGFNAVVH 226 KGSY H+ DG RT+EY + G+ H Sbjct: 1742 KGSYDTHDVDGRRRTIEYYSGTPQGYLPPAH 1772 >SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) Length = 473 Score = 31.5 bits (68), Expect = 0.68 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Query: 175 VADGHSGDNKSQQEVRDGDVVKGSYSFHEADGSIRTVEYTADDHSGFNAVVHNTAPTAAP 234 V D GD + GD V+ S SF G V Y A G A + ++ PT Sbjct: 187 VCDSFQGDYARVSDSFQGDYVRVSDSFQSFQGDYARVRYAAAGFFGRQA-IDDSRPTLEE 245 Query: 235 THIKAVPALQYYHH 248 + + Y HH Sbjct: 246 SRLHEGTKYGYGHH 259 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.125 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,008,128 Number of Sequences: 59808 Number of extensions: 184487 Number of successful extensions: 280 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 279 Number of HSP's gapped (non-prelim): 2 length of query: 248 length of database: 16,821,457 effective HSP length: 80 effective length of query: 168 effective length of database: 12,036,817 effective search space: 2022185256 effective search space used: 2022185256 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -