BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000265-TA|BGIBMGA000265-PA|IPR000618|Insect cuticle protein (248 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 25 0.41 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 1.7 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 8.9 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 8.9 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 25.4 bits (53), Expect = 0.41 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Query: 186 QQEVRDGDVVKGSYSF--HEADGSIRTVEYTAD 216 ++ DG +V G Y H+ DGS+R V YTAD Sbjct: 208 EERTSDGFIV-GEYGVVSHD-DGSLRGVRYTAD 238 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 23.4 bits (48), Expect = 1.7 Identities = 16/48 (33%), Positives = 23/48 (47%) Query: 192 GDVVKGSYSFHEADGSIRTVEYTADDHSGFNAVVHNTAPTAAPTHIKA 239 GD+ KG+++ EA I T G+NA AP AA ++A Sbjct: 76 GDIEKGNFAEVEALKEINPNLKTIISIGGWNAGNAILAPIAASPELRA 123 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 196 KGSYSFHEADGSIRTVEYTADDHSG 220 K SY+ + G I V+ T DD G Sbjct: 390 KASYARAKGLGGIAIVDITLDDFRG 414 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.0 bits (42), Expect = 8.9 Identities = 12/43 (27%), Positives = 18/43 (41%) Query: 206 GSIRTVEYTADDHSGFNAVVHNTAPTAAPTHIKALPALQYYHH 248 G +R V+ AD S HN A + P++ YY + Sbjct: 3 GFVRQVKQEADSTSPLLTPPHNPAYSPPPSYCDPWYNPYYYQY 45 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.126 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,284 Number of Sequences: 317 Number of extensions: 1230 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 248 length of database: 114,650 effective HSP length: 55 effective length of query: 193 effective length of database: 97,215 effective search space: 18762495 effective search space used: 18762495 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -