BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000265-TA|BGIBMGA000265-PA|IPR000618|Insect cuticle protein (248 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1469 - 26742772-26743848 30 1.5 06_03_1282 - 28946363-28946533,28947234-28947272,28947399-289475... 29 4.7 >07_03_1469 - 26742772-26743848 Length = 358 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Query: 195 VKGSYSFHEADGSIRTVEYTADDHSGFNAVVHNTAPTAAPTHIKALPALQYYH 247 V+ S A G++R+ ++T D G A V AP AA +P + YYH Sbjct: 61 VRADPSPDAATGAVRSFDFTIDAARGLWARVF--APAAAAQAAAPMPVMVYYH 111 >06_03_1282 - 28946363-28946533,28947234-28947272,28947399-28947566, 28947605-28947697,28948135-28948215,28948409-28948499, 28948657-28948728,28948803-28948903,28949283-28949381, 28949631-28949954 Length = 412 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 5 IVVLCALV-AVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQ 44 IV+L A V AV L P HY+P VSS S P+ Sbjct: 15 IVILIAFVCAVGIGAYLYTPQHYTPCYLVSSNSCSSRPPPE 55 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.313 0.126 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,278,683 Number of Sequences: 37544 Number of extensions: 167288 Number of successful extensions: 302 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 302 Number of HSP's gapped (non-prelim): 2 length of query: 248 length of database: 14,793,348 effective HSP length: 80 effective length of query: 168 effective length of database: 11,789,828 effective search space: 1980691104 effective search space used: 1980691104 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -