BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000265-TA|BGIBMGA000265-PA|IPR000618|Insect cuticle protein (248 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) 31 0.89 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 196 KGSYSFHEADGSIRTVEYTADDHSGFNAVVHNTAPTAAPTHIKAL 240 KGSY H+ DG RT+EY + G+ H T P +I L Sbjct: 1742 KGSYDTHDVDGRRRTIEYYSGTPQGYLPPAH-TRPYPVQPNIYRL 1785 >SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) Length = 473 Score = 31.1 bits (67), Expect = 0.89 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Query: 175 VADGHSGDNKSQQEVRDGDVVKGSYSFHEADGSIRTVEYTADDHSGFNAVVHNTAPTAAP 234 V D GD + GD V+ S SF G V Y A G A + ++ PT Sbjct: 187 VCDSFQGDYARVSDSFQGDYVRVSDSFQSFQGDYARVRYAAAGFFGRQA-IDDSRPTLEE 245 Query: 235 THIKALPALQYYHH 248 + + Y HH Sbjct: 246 SRLHEGTKYGYGHH 259 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.126 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,981,881 Number of Sequences: 59808 Number of extensions: 183155 Number of successful extensions: 275 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 274 Number of HSP's gapped (non-prelim): 2 length of query: 248 length of database: 16,821,457 effective HSP length: 80 effective length of query: 168 effective length of database: 12,036,817 effective search space: 2022185256 effective search space used: 2022185256 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -