BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000265-TA|BGIBMGA000265-PA|IPR000618|Insect cuticle protein (248 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 32 0.006 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 31.9 bits (69), Expect = 0.006 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 5/95 (5%) Query: 154 AKIVAHQAEEIAYPKYEYNYSVADGHSGDNKSQQEVRDGD---VVKGSYSFHEADGSIRT 210 A I + Q E Y N+ ++G S Q + D + V +GS S+ DG + Sbjct: 27 AVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPVVSQGSDSYTAPDGQQVS 86 Query: 211 VEYTADDHSGFNAVVHNTAPTAAPTHIKALPALQY 245 + Y AD+ +GF V + PTA P + AL++ Sbjct: 87 ITYVADE-NGFQ-VQGSHIPTAPPIPPEIQRALEW 119 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.126 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,654 Number of Sequences: 429 Number of extensions: 1501 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 1 length of query: 248 length of database: 140,377 effective HSP length: 56 effective length of query: 192 effective length of database: 116,353 effective search space: 22339776 effective search space used: 22339776 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -