BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000263-TA|BGIBMGA000263-PA|IPR000618|Insect cuticle protein (224 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980,648... 28 7.1 08_02_0602 + 19183549-19184919 27 9.3 >03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980, 6483158-6483234,6483990-6485312 Length = 691 Score = 27.9 bits (59), Expect = 7.1 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 147 DFAYSVADGHSGDNKSQHESRDGDAVHGEYTLLEADGSVRK--VEYTADDHHGF-NAV 201 ++A S DG G KSQ + RD D GE + + +K V ++ + H F NAV Sbjct: 162 EYASSANDGAEGSWKSQKKKRDKDDDDGELESGDPSSTSKKPRVVWSVELHQQFVNAV 219 >08_02_0602 + 19183549-19184919 Length = 456 Score = 27.5 bits (58), Expect = 9.3 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 118 AAPEARVIAPAHKVLVAGHHEEE---YAHPKYDFAYSVADGHSGDNKSQHESRDG 169 A + V + +L++ HE YA+ + D A ADGH ++SQ E G Sbjct: 214 ACADLDVTSSNQPLLLSAEHEVVDALYANQEADAAILHADGHHNQDESQREHHHG 268 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.130 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,614,116 Number of Sequences: 37544 Number of extensions: 153057 Number of successful extensions: 301 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 301 Number of HSP's gapped (non-prelim): 2 length of query: 224 length of database: 14,793,348 effective HSP length: 79 effective length of query: 145 effective length of database: 11,827,372 effective search space: 1714968940 effective search space used: 1714968940 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -