BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000262-TA|BGIBMGA000262-PA|IPR000618|Insect cuticle protein (110 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_1052 - 22567937-22568329,22568436-22568669,22568787-225691... 28 1.4 01_01_0616 + 4586086-4586835 27 3.3 06_01_0504 + 3632108-3632281,3633532-3633699,3633797-3633883,363... 27 4.4 >10_08_1052 - 22567937-22568329,22568436-22568669,22568787-22569111, 22569239-22569484,22569576-22569916,22570070-22570150, 22570275-22570394,22570549-22570650,22570900-22571035, 22571210-22571362,22572605-22572906 Length = 810 Score = 28.3 bits (60), Expect = 1.4 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 62 EDHHTKDHKSQHETRDGDAVKGYY-ALHEPDGSERHVDYHSDKHSGY 107 + HH + + + E++ A YY HE + H YH +H + Sbjct: 739 QHHHRQVEEEEEESKSSQATTHYYHHHHEQTTTTTHHHYHQHEHMSH 785 >01_01_0616 + 4586086-4586835 Length = 249 Score = 27.1 bits (57), Expect = 3.3 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 80 AVKGYYALHEPDGSERHVDYHSD 102 A +G YA H PDG H D+ D Sbjct: 71 AGRGVYATHGPDGCRVHPDFVED 93 >06_01_0504 + 3632108-3632281,3633532-3633699,3633797-3633883, 3634766-3634876,3635114-3635205,3635288-3635393, 3635475-3635561,3637796-3638209 Length = 412 Score = 26.6 bits (56), Expect = 4.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Query: 76 RDGDAVKGYYALHEPDGS 93 RDG AV GY A +PDG+ Sbjct: 6 RDGAAVAGYMAEDDPDGA 23 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,627,180 Number of Sequences: 37544 Number of extensions: 81951 Number of successful extensions: 198 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 196 Number of HSP's gapped (non-prelim): 3 length of query: 110 length of database: 14,793,348 effective HSP length: 72 effective length of query: 38 effective length of database: 12,090,180 effective search space: 459426840 effective search space used: 459426840 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -