BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000262-TA|BGIBMGA000262-PA|IPR000618|Insect cuticle protein (110 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 76 3e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 75 6e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 75 8e-16 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 57 2e-10 AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding pr... 23 3.3 AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 23 3.3 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 75.8 bits (178), Expect = 3e-16 Identities = 32/53 (60%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 74.9 bits (176), Expect = 6e-16 Identities = 32/53 (60%), Positives = 37/53 (69%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D KSQHETR GD V G Y+L + DG R VDYH+D H+G+ Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 74.5 bits (175), Expect = 8e-16 Identities = 31/53 (58%), Positives = 38/53 (71%) Query: 55 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 YEF Y V D HT D K+QHETR GD V G Y+L + DG +R VDYH+D H+G+ Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 56.8 bits (131), Expect = 2e-10 Identities = 23/42 (54%), Positives = 33/42 (78%) Query: 66 TKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHSGY 107 T D KSQ E+RDGD V+G Y++ +PDG++R VDY +D H+G+ Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding protein AgamOBP35 protein. Length = 277 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 3 IKVLMLVTVIGAVAAEHA 20 + + LV +IG++ AEH+ Sbjct: 6 VSAIALVAIIGSIQAEHS 23 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 3 IKVLMLVTVIGAVAAEHA 20 + + LV +IG++ AEH+ Sbjct: 6 VSAIALVAIIGSIQAEHS 23 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,074 Number of Sequences: 2123 Number of extensions: 2944 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 16 length of query: 110 length of database: 516,269 effective HSP length: 56 effective length of query: 54 effective length of database: 397,381 effective search space: 21458574 effective search space used: 21458574 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -