BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000262-TA|BGIBMGA000262-PA|IPR000618|Insect cuticle protein (110 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 3.4 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 3.4 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.0 bits (42), Expect = 3.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 10 TVIGAVAAEHAFSSQHI 26 T +GAVA E F ++H+ Sbjct: 142 TPLGAVATEKMFVARHL 158 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.0 bits (42), Expect = 3.4 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Query: 63 DHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVDYHSDKHS 105 +H K H+ H G+ V HE GS++ ++ H HS Sbjct: 244 NHVLKLHQVAHY---GEKVYKCTLCHETFGSKKTMELHIKTHS 283 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,202 Number of Sequences: 429 Number of extensions: 775 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 110 length of database: 140,377 effective HSP length: 50 effective length of query: 60 effective length of database: 118,927 effective search space: 7135620 effective search space used: 7135620 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.7 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -