BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000261-TA|BGIBMGA000261-PA|undefined
(59 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q8IK06 Cluster: Putative uncharacterized protein; n=6; ... 30 7.9
>UniRef50_Q8IK06 Cluster: Putative uncharacterized protein; n=6;
Plasmodium|Rep: Putative uncharacterized protein -
Plasmodium falciparum (isolate 3D7)
Length = 1303
Score = 30.3 bits (65), Expect = 7.9
Identities = 13/30 (43%), Positives = 20/30 (66%)
Query: 28 RKRVLSQRYPNKSYQNQNLQTENIIIKLKS 57
+K+VL +RY + Y N N +++N II KS
Sbjct: 791 KKKVLGKRYEEEKYNNNNNKSKNSIIFKKS 820
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.322 0.137 0.370
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,470,555
Number of Sequences: 1657284
Number of extensions: 692780
Number of successful extensions: 2706
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2705
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 575,637,011
effective HSP length: 39
effective length of query: 20
effective length of database: 511,002,935
effective search space: 10220058700
effective search space used: 10220058700
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 65 (30.3 bits)
- SilkBase 1999-2023 -