GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000261-TA|BGIBMGA000261-PA|undefined
         (59 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IK06 Cluster: Putative uncharacterized protein; n=6; ...    30   7.9  

>UniRef50_Q8IK06 Cluster: Putative uncharacterized protein; n=6;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium falciparum (isolate 3D7)
          Length = 1303

 Score = 30.3 bits (65), Expect = 7.9
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 28  RKRVLSQRYPNKSYQNQNLQTENIIIKLKS 57
           +K+VL +RY  + Y N N +++N II  KS
Sbjct: 791 KKKVLGKRYEEEKYNNNNNKSKNSIIFKKS 820


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.322    0.137    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,470,555
Number of Sequences: 1657284
Number of extensions: 692780
Number of successful extensions: 2706
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2705
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 575,637,011
effective HSP length: 39
effective length of query: 20
effective length of database: 511,002,935
effective search space: 10220058700
effective search space used: 10220058700
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 65 (30.3 bits)