Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000260-TA|BGIBMGA000260-PA|IPR000618|Insect cuticle
protein
         (178 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       27   0.12 

>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 26.6 bits (56), Expect = 0.12
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 109 YKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSAD 152
           Y VE  +    + +  T DG +V     +   DG++R V Y+AD
Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.312    0.130    0.368 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,243
Number of Sequences: 317
Number of extensions: 535
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 178
length of database: 114,650
effective HSP length: 53
effective length of query: 125
effective length of database: 97,849
effective search space: 12231125
effective search space used: 12231125
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.4 bits)
S2: 41 (20.6 bits)