BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000260-TA|BGIBMGA000260-PA|IPR000618|Insect cuticle protein (178 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_30178| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 132 KGVYSLHEADGTIRTVEYSADKHSGF 157 KG Y H+ DG RT+EY + G+ Sbjct: 1742 KGSYDTHDVDGRRRTIEYYSGTPQGY 1767 >SB_30178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 3.8 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 108 EYKVEDPHTGDNKYQHETRDGDVVKGVYSLHE-ADGTIRTVEYSADKHSGFNAVVR 162 EY + H Y++ TR V++ Y++HE A TI + H+ +V+R Sbjct: 44 EYPMSTIHDARVCYEYHTRCTSVLRVPYTMHECATSTIHDARVCYEYHTRCTSVLR 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.312 0.130 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,884,872 Number of Sequences: 59808 Number of extensions: 86861 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 119 Number of HSP's gapped (non-prelim): 2 length of query: 178 length of database: 16,821,457 effective HSP length: 78 effective length of query: 100 effective length of database: 12,156,433 effective search space: 1215643300 effective search space used: 1215643300 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -