SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000260-TA|BGIBMGA000260-PA|IPR000618|Insect cuticle
protein
         (178 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g22580.1 68418.m02637 expressed protein                             27   5.4  

>At5g22580.1 68418.m02637 expressed protein
          Length = 111

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 10/36 (27%), Positives = 23/36 (63%)

Query: 120 KYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHS 155
           K++ +T+  +++KG+ +L     T+++ E+  DK S
Sbjct: 13  KFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKES 48


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.312    0.130    0.368 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,988,018
Number of Sequences: 28952
Number of extensions: 58569
Number of successful extensions: 73
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 72
Number of HSP's gapped (non-prelim): 1
length of query: 178
length of database: 12,070,560
effective HSP length: 77
effective length of query: 101
effective length of database: 9,841,256
effective search space: 993966856
effective search space used: 993966856
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 56 (26.6 bits)

- SilkBase 1999-2023 -