BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000260-TA|BGIBMGA000260-PA|IPR000618|Insect cuticle protein (178 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 84 3e-18 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 84 3e-18 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 81 2e-17 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 76 5e-16 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 9.4 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAVVRRE 151 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 175 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 83.8 bits (198), Expect = 3e-18 Identities = 39/60 (65%), Positives = 43/60 (71%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVRRE Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 81.0 bits (191), Expect = 2e-17 Identities = 38/60 (63%), Positives = 42/60 (70%) Query: 105 YAFEYKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 Y F Y V D HTGD K QHETR GD V G YSL ++DG R V+Y AD H+GFNAVVR E Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRPE 143 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 76.2 bits (179), Expect = 5e-16 Identities = 34/49 (69%), Positives = 42/49 (85%) Query: 116 TGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRRE 164 TGD+K Q E+RDGDVV+G YS+ + DGT RTV+Y+AD H+GFNAVVRRE Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRRE 82 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 3.1 Identities = 7/26 (26%), Positives = 16/26 (61%) Query: 138 HEADGTIRTVEYSADKHSGFNAVVRR 163 H++DG + E+ KH ++ +++R Sbjct: 2511 HDSDGAVIQAEHKGIKHMAYDKLLQR 2536 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.2 bits (45), Expect = 9.4 Identities = 6/26 (23%), Positives = 15/26 (57%) Query: 138 HEADGTIRTVEYSADKHSGFNAVVRR 163 H+ DG + ++ KH ++ +++R Sbjct: 2521 HDGDGAVIQAQHKGIKHMAYDKLLQR 2546 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.130 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,831 Number of Sequences: 2123 Number of extensions: 2240 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 16 length of query: 178 length of database: 516,269 effective HSP length: 60 effective length of query: 118 effective length of database: 388,889 effective search space: 45888902 effective search space used: 45888902 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -