BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000259-TA|BGIBMGA000259-PA|IPR000618|Insect cuticle protein, IPR002395|HMW kininogen (177 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 27 0.12 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 26.6 bits (56), Expect = 0.12 Identities = 14/44 (31%), Positives = 22/44 (50%) Query: 108 YKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSAD 151 Y VE + + + T DG +V + DG++R V Y+AD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.131 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,705 Number of Sequences: 317 Number of extensions: 625 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 177 length of database: 114,650 effective HSP length: 53 effective length of query: 124 effective length of database: 97,849 effective search space: 12133276 effective search space used: 12133276 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -