SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000259-TA|BGIBMGA000259-PA|IPR000618|Insect cuticle
protein, IPR002395|HMW kininogen
         (177 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAP14E8.03 |bos1||SNARE Bos1|Schizosaccharomyces pombe|chr 1|||...    25   4.8  

>SPAP14E8.03 |bos1||SNARE Bos1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 235

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 11/46 (23%), Positives = 22/46 (47%)

Query: 117 DNKYQHETRDGDVVKGVYSLHEADGTIRTVEYSADKHSGFNAVVRR 162
           D+ Y + T D ++V+G   L   DG ++  ++     S  +  + R
Sbjct: 121 DSPYGNSTTDAEIVEGPSDLSRQDGLLKEHDFLGRAESQVDEFLER 166


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 438,015
Number of Sequences: 5004
Number of extensions: 13054
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 177
length of database: 2,362,478
effective HSP length: 68
effective length of query: 109
effective length of database: 2,022,206
effective search space: 220420454
effective search space used: 220420454
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -