BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000258-TA|BGIBMGA000258-PA|IPR000618|Insect cuticle protein (101 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 75 5e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 74 1e-15 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 60 2e-11 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 2.2 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 109 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 74.9 bits (176), Expect = 5e-16 Identities = 32/59 (54%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD KSQHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 73.7 bits (173), Expect = 1e-15 Identities = 31/59 (52%), Positives = 39/59 (66%) Query: 43 DYYTHPKFDFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 +++ ++F Y V D HTGD K+QHE+R GD V G YSL DG R VDYH DHH+G Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 59.7 bits (138), Expect = 2e-11 Identities = 27/41 (65%), Positives = 31/41 (75%) Query: 61 TGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 TGD KSQ ESRDGDVV+G YS+ PDG+ R VDY D H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 47 HPKFDFEYKVSDPHTGDHKSQHESRDGDVVK 77 H +FD E GDH + + D D+V+ Sbjct: 305 HVEFDIEGSKMRYEAGDHLAMYPVNDRDLVE 335 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.136 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,999 Number of Sequences: 2123 Number of extensions: 4347 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 15 length of query: 101 length of database: 516,269 effective HSP length: 55 effective length of query: 46 effective length of database: 399,504 effective search space: 18377184 effective search space used: 18377184 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -