BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000256-TA|BGIBMGA000256-PA|IPR000618|Insect cuticle protein (101 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 76 3e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 76 3e-16 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 75 7e-16 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 58 5e-11 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 0.53 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 25 0.70 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 1.6 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 23 2.2 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 23 2.2 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 23 2.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 22 3.8 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 22 3.8 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 22 3.8 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 21 6.6 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 21 8.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 21 8.7 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 75.8 bits (178), Expect = 3e-16 Identities = 33/52 (63%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 74.9 bits (176), Expect = 5e-16 Identities = 33/52 (63%), Positives = 35/52 (67%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD KSQHE+R GD V G YSL DG R V YH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 74.5 bits (175), Expect = 7e-16 Identities = 32/52 (61%), Positives = 36/52 (69%) Query: 50 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 YEF Y V D HTGD K+QHE+R GD V G YSL DG +R V YH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 58.4 bits (135), Expect = 5e-11 Identities = 26/41 (63%), Positives = 31/41 (75%) Query: 61 TGDHKSQHESRDGDVVKGYYSLHQPDGSERHVHYHGDHHSG 101 TGD KSQ ESRDGDVV+G YS+ PDG++R V Y D H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 0.53 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 79 YYSLHQPDGSERHVHYHGDHH 99 ++ QP ++H H+H HH Sbjct: 641 HHQSQQPQQQQQHQHHHHHHH 661 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 24.6 bits (51), Expect = 0.70 Identities = 12/37 (32%), Positives = 13/37 (35%), Gaps = 1/37 (2%) Query: 64 HKSQHESRD-GDVVKGYYSLHQPDGSERHVHYHGDHH 99 H H S G V G H H H+H HH Sbjct: 476 HSPHHVSPGMGSTVNGASLTHSHHAHPHHHHHHHHHH 512 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 80 YSLHQPDGSERHVHYHGDHH 99 Y Q G +H H+H HH Sbjct: 172 YHQQQHPGHSQHHHHHHHHH 191 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 79 YYSLHQPDGSERHVHYHGDHH 99 Y ++ +P S +H H+ HH Sbjct: 15 YTTVSEPSASTKHRHHSRHHH 35 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 79 YYSLHQPDGSERHVHYHGDHH 99 Y ++ +P S +H H+ HH Sbjct: 15 YTTVSEPSASTKHRHHSRHHH 35 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 79 YYSLHQPDGSERHVHYHGDHH 99 Y ++ +P S +H H+ HH Sbjct: 15 YTTVSEPSASTKHRHHSRHHH 35 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 81 SLHQPDGSERHVHYHGDHHSG 101 S HQ + H H+H H G Sbjct: 273 SQHQQPTHQTHHHHHHHQHGG 293 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 81 SLHQPDGSERHVHYHGDHHSG 101 S HQ + H H+H H G Sbjct: 273 SQHQQPTHQTHHHHHHHQHGG 293 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 81 SLHQPDGSERHVHYHGDHHSG 101 S HQ + H H+H H G Sbjct: 225 SQHQQPTHQTHHHHHHHQHGG 245 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/22 (36%), Positives = 10/22 (45%) Query: 78 GYYSLHQPDGSERHVHYHGDHH 99 G +LH H H+H HH Sbjct: 109 GSGALHLGQNPNLHHHHHHHHH 130 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 75 VVKGYYSLHQPDGSE 89 V+K YS H DGSE Sbjct: 267 VMKAAYSCHWYDGSE 281 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 81 SLHQPDGSERHVHYHGDHHS 100 S H P G+ H +H HH+ Sbjct: 807 SSHSPVGAGSHHLHHLHHHA 826 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.132 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,476 Number of Sequences: 2123 Number of extensions: 3063 Number of successful extensions: 26 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of query: 101 length of database: 516,269 effective HSP length: 55 effective length of query: 46 effective length of database: 399,504 effective search space: 18377184 effective search space used: 18377184 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -