BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000253-TA|BGIBMGA000253-PA|IPR000618|Insect cuticle protein (119 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15D4.12c |mug98||sequence orphan|Schizosaccharomyces pombe|c... 26 1.4 SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces ... 25 2.4 SPAC11D3.01c |||conserved fungal protein|Schizosaccharomyces pom... 24 7.4 SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein P... 23 9.7 >SPBC15D4.12c |mug98||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 113 Score = 26.2 bits (55), Expect = 1.4 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 66 PKYEFEYKVSDPHTGDHKSQHESRDGD-VVKGYYSLHQPDGSIRHVDY 112 P Y E K++ ++ ++ + +G YY H P+G+ HV Y Sbjct: 66 PLYNVEAKINHSYSAFYRPFTKRENGLWYANPYYMQHGPNGNYHHVYY 113 >SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.4 bits (53), Expect = 2.4 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Query: 68 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 Y +Y S P T + S+ ++ D V G + GS H HG +H G Sbjct: 170 YGEDYSQSYP-TDTYGSRQKATPSDTVGGGAYDYSSSGSHTHGGSHGTEHRG 220 >SPAC11D3.01c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 79 Score = 23.8 bits (49), Expect = 7.4 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 71 EYKVSDPHTGDHKSQHESRDGDVVKGY-YSLHQPDGS 106 E + + H G+ +H+ G+V GY ++H P+ S Sbjct: 28 EKEYLEEHEGEVGEEHQKNTGNVRGGYKAAMHNPNVS 64 >SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein Pvg2|Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 23.4 bits (48), Expect = 9.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 68 YEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLH 101 +E E +VS P+ H+ + V K Y++LH Sbjct: 142 FEVELRVSHPNWAFVSWSHDDLNELVDKSYHNLH 175 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.317 0.134 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,076 Number of Sequences: 5004 Number of extensions: 16545 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 35 Number of HSP's gapped (non-prelim): 4 length of query: 119 length of database: 2,362,478 effective HSP length: 65 effective length of query: 54 effective length of database: 2,037,218 effective search space: 110009772 effective search space used: 110009772 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -