BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000253-TA|BGIBMGA000253-PA|IPR000618|Insect cuticle protein (119 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 77 2e-16 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 75 7e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 75 7e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 74 2e-15 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 60 2e-11 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 22 6.6 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 76.6 bits (180), Expect = 2e-16 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 3/108 (2%) Query: 15 ATAQYGHDQSHGHAFSSQHISRHDGPA---QXXXXXXXXXXXXXXXXXXXYYAHPKYEFE 71 A A Y H + S+ I +H PA ++A YEF Sbjct: 60 APAIYQHSAPAIYQHSAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFS 119 Query: 72 YKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 120 YSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 74.9 bits (176), Expect = 7e-16 Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD KSQHE+R GD V G YSL DG R VDYH D H+G Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 73.7 bits (173), Expect = 2e-15 Identities = 33/58 (56%), Positives = 38/58 (65%) Query: 62 YYAHPKYEFEYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 ++A YEF Y V D HTGD K+QHE+R GD V G YSL DG R VDYH D H+G Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 60.1 bits (139), Expect = 2e-11 Identities = 27/41 (65%), Positives = 31/41 (75%) Query: 79 TGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDKHSG 119 TGD KSQ ESRDGDVV+G YS+ PDG+ R VDY D H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 20 GHDQSHGHAFSSQHISRHDGP 40 GH +SH +++ H + H P Sbjct: 225 GHMRSHHQHYTANHQNGHSAP 245 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.134 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,752 Number of Sequences: 2123 Number of extensions: 4453 Number of successful extensions: 18 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 15 length of query: 119 length of database: 516,269 effective HSP length: 57 effective length of query: 62 effective length of database: 395,258 effective search space: 24505996 effective search space used: 24505996 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -