BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000252-TA|BGIBMGA000252-PA|IPR000618|Insect cuticle protein (228 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 28 0.99 SPCC1223.11 |ptc2||protein phosphatase 2C Ptc2 |Schizosaccharomy... 25 9.2 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 28.3 bits (60), Expect = 0.99 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 23 QKSQWEARDGDVVKGQYSLVEPDGTVRTVDYSADDHN 59 +KS W R D+++G +L P+ T+ + DH+ Sbjct: 244 EKSHWRERIWDLIQGMVTLHIPEQAAWTIYFEWQDHS 280 >SPCC1223.11 |ptc2||protein phosphatase 2C Ptc2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 370 Score = 25.0 bits (52), Expect = 9.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query: 5 SHPRYQFNYGVTDGHTGDQKSQW-EARDGDVVKGQYS 40 S+P F +GV DGH GD+ +++ D++K Q S Sbjct: 52 SNPPTSF-FGVFDGHGGDRVAKYCRQHLPDIIKSQPS 87 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.313 0.132 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 955,859 Number of Sequences: 5004 Number of extensions: 32275 Number of successful extensions: 47 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 46 Number of HSP's gapped (non-prelim): 2 length of query: 228 length of database: 2,362,478 effective HSP length: 70 effective length of query: 158 effective length of database: 2,012,198 effective search space: 317927284 effective search space used: 317927284 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -