BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000251-TA|BGIBMGA000251-PA|IPR000618|Insect cuticle protein (397 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 32 0.010 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 24 2.6 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 31.9 bits (69), Expect = 0.010 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 15/111 (13%) Query: 174 THSIS--IKHPRDEGSESEAHSHFGYSFDPNCKTKPKKGSHDTNSYSN-VVDLETNPK-- 228 THS S + PRD E E + T K +H T ++ V + P+ Sbjct: 281 THSDSSVVGSPRDSPIEPEIEIS-----QNSVSTGSDKENHKTEEPNDEVATYDNTPRDF 335 Query: 229 -YPLYSQDYFRDKHPDSSSNYDFEKLRPFSSYRPHKYEEITLKPPFSTRYT 278 Y +YS++ + H S+ N DF+ S +PH + L P S+ YT Sbjct: 336 PYYMYSREQYSQSHLISNENRDFQTTPTVSVEQPHLF----LYPEVSSTYT 382 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 23.8 bits (49), Expect = 2.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Query: 154 REHSKNKKPRYPF 166 R+H N+KPR PF Sbjct: 4 RKHKPNRKPRTPF 16 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.133 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,068 Number of Sequences: 429 Number of extensions: 5178 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 397 length of database: 140,377 effective HSP length: 59 effective length of query: 338 effective length of database: 115,066 effective search space: 38892308 effective search space used: 38892308 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -