BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000250-TA|BGIBMGA000250-PA|IPR000618|Insect cuticle protein (144 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC015725-1|AAH15725.2| 313|Homo sapiens BHD protein protein. 29 7.8 AF517523-1|AAM94803.1| 579|Homo sapiens folliculin protein. 29 7.8 >BC015725-1|AAH15725.2| 313|Homo sapiens BHD protein protein. Length = 313 Score = 28.7 bits (61), Expect = 7.8 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Query: 81 WESRDGDVVKGAYSLAE---PDGTTRIVEYTADKHNGFNAVVKRIGQAHHPQV 130 W+SRD D+V+ A+ + P G RI+ Y++ + +G + H Q+ Sbjct: 110 WKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRC--NFLGLSPHVQI 160 >AF517523-1|AAM94803.1| 579|Homo sapiens folliculin protein. Length = 579 Score = 28.7 bits (61), Expect = 7.8 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Query: 81 WESRDGDVVKGAYSLAE---PDGTTRIVEYTADKHNGFNAVVKRIGQAHHPQV 130 W+SRD D+V+ A+ + P G RI+ Y++ + +G + H Q+ Sbjct: 376 WKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRC--NFLGLSPHVQI 426 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.135 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,509,810 Number of Sequences: 224733 Number of extensions: 377688 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 511 Number of HSP's gapped (non-prelim): 2 length of query: 144 length of database: 73,234,838 effective HSP length: 83 effective length of query: 61 effective length of database: 54,581,999 effective search space: 3329501939 effective search space used: 3329501939 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -