BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000250-TA|BGIBMGA000250-PA|IPR000618|Insect cuticle protein (144 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 25 0.35 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 1.9 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 1.9 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 1.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 10.0 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 24.6 bits (51), Expect = 0.35 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 67 YSVNDPHTGDHKTQWESRDGDVVKGAYSL-AEPDGTTRIVEYTAD 110 Y V + ++ + + DG +V G Y + + DG+ R V YTAD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIV-GEYGVVSHDDGSLRGVRYTAD 238 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 22.2 bits (45), Expect = 1.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 92 AYSLAEPDGTTRIVEYTADKHN 113 A+ LA P GTTR++ A +N Sbjct: 328 AFMLAHPYGTTRLMSSFAFDNN 349 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.2 bits (45), Expect = 1.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 92 AYSLAEPDGTTRIVEYTADKHN 113 A+ LA P GTTR++ A +N Sbjct: 329 AFMLAHPYGTTRLMSSFAFDNN 350 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.2 bits (45), Expect = 1.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 92 AYSLAEPDGTTRIVEYTADKHN 113 A+ LA P GTTR++ A +N Sbjct: 329 AFMLAHPYGTTRLMSSFAFDNN 350 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.8 bits (39), Expect = 10.0 Identities = 9/24 (37%), Positives = 10/24 (41%) Query: 64 AFDYSVNDPHTGDHKTQWESRDGD 87 AFD+ DH SR GD Sbjct: 364 AFDFHREREPVADHHANLYSRPGD 387 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,603 Number of Sequences: 317 Number of extensions: 664 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 144 length of database: 114,650 effective HSP length: 51 effective length of query: 93 effective length of database: 98,483 effective search space: 9158919 effective search space used: 9158919 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.9 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -