BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000250-TA|BGIBMGA000250-PA|IPR000618|Insect cuticle protein (144 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27) 29 2.0 >SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27) Length = 1154 Score = 28.7 bits (61), Expect = 2.0 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query: 69 VNDPHTGDHKTQWES---RDGDVVKGAYSLAEPDGTTRIVEYTADKHNG 114 V DP +K++ E +DG +++GA + P G R++E + H G Sbjct: 665 VKDPELLPYKSKREELSVQDGCILRGARVVVPPQGRKRVLEDLHEAHPG 713 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.320 0.135 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,147,485 Number of Sequences: 59808 Number of extensions: 108971 Number of successful extensions: 252 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 252 Number of HSP's gapped (non-prelim): 1 length of query: 144 length of database: 16,821,457 effective HSP length: 76 effective length of query: 68 effective length of database: 12,276,049 effective search space: 834771332 effective search space used: 834771332 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -