GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000250-TA|BGIBMGA000250-PA|IPR000618|Insect cuticle
protein
         (144 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27)                 29   2.0  

>SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27)
          Length = 1154

 Score = 28.7 bits (61), Expect = 2.0
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 69  VNDPHTGDHKTQWES---RDGDVVKGAYSLAEPDGTTRIVEYTADKHNG 114
           V DP    +K++ E    +DG +++GA  +  P G  R++E   + H G
Sbjct: 665 VKDPELLPYKSKREELSVQDGCILRGARVVVPPQGRKRVLEDLHEAHPG 713


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.135    0.423 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,147,485
Number of Sequences: 59808
Number of extensions: 108971
Number of successful extensions: 252
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 252
Number of HSP's gapped (non-prelim): 1
length of query: 144
length of database: 16,821,457
effective HSP length: 76
effective length of query: 68
effective length of database: 12,276,049
effective search space: 834771332
effective search space used: 834771332
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 56 (26.6 bits)