BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000249-TA|BGIBMGA000249-PA|IPR000618|Insect cuticle protein (178 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 49 7e-08 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 41 3e-05 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 41 3e-05 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 40 3e-05 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 40 3e-05 AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. 24 2.3 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 24 2.3 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 24 2.3 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 24 2.3 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 2.3 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 49.2 bits (112), Expect = 7e-08 Identities = 21/31 (67%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G YS+V+PDG+ RTVDYTAD +GFNAVV + Sbjct: 51 GSYSVVDPDGTKRTVDYTADPHNGFNAVVRR 81 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 120 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 120 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 144 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 174 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 120 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 40.7 bits (91), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 120 GQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 40.3 bits (90), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL++ DG R VDY AD GFNAVV + Sbjct: 120 GQYSLLDSDGHHRIVDYHADHHTGFNAVVRR 150 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 40.3 bits (90), Expect = 3e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVV 32 GQYSL++ DG R VDY AD GFNAVV Sbjct: 112 GQYSLLDSDGHQRIVDYHADHHTGFNAVV 140 >AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 24.2 bits (50), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 7 SLVEPDGSVRTVDYTADSLHGFNAVVSKS 35 ++ E DG+++ +YT +L GF V +S Sbjct: 227 AVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 24.2 bits (50), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 7 SLVEPDGSVRTVDYTADSLHGFNAVVSKS 35 ++ E DG+++ +YT +L GF V +S Sbjct: 227 AVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 24.2 bits (50), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 7 SLVEPDGSVRTVDYTADSLHGFNAVVSKS 35 ++ E DG+++ +YT +L GF V +S Sbjct: 227 AVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 24.2 bits (50), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 7 SLVEPDGSVRTVDYTADSLHGFNAVVSKS 35 ++ E DG+++ +YT +L GF V +S Sbjct: 227 AVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 7 SLVEPDGSVRTVDYTADSLHGFNAVVSKS 35 ++ E DG+++ +YT +L GF V +S Sbjct: 1366 AVAEGDGTLQKANYTYQTLAGFKNQVEES 1394 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.139 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,486 Number of Sequences: 2123 Number of extensions: 3512 Number of successful extensions: 27 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 19 length of query: 178 length of database: 516,269 effective HSP length: 60 effective length of query: 118 effective length of database: 388,889 effective search space: 45888902 effective search space used: 45888902 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -